PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_024887-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family CO-like
Protein Properties Length: 418aa    MW: 46174.6 Da    PI: 6.0231
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_024887-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.16.6e-074586540
       zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    C+ ++e ++ l+C+ +   lC +C  e H+g      H+++
  NNU_024887-RA 45 LCDFCGESRAPLYCRADTAKLCFSCDREVHSGnplfgkHSRS 86
                   6*****************************888888888765 PP

2zf-B_box27.85.3e-0985133241
       zf-B_box   2 eerkCpeHeekelqlfCedCqqllCedClleeHkg.........Htvvp 41 
                    + + C+ + +k++++fC +++  lC++C    H g         H+++p
  NNU_024887-RA  85 RSQLCDACASKPASIFCSTDNLVLCQNCDWDAHGGcssssssslHDRRP 133
                    5689*************************99995577778888887766 PP

3CCT54.15.6e-19374417144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    R+ a++RYkeK+k R+++K+i YesR ++Ae R R+KGrF+k++
  NNU_024887-RA 374 RDLAISRYKEKKKARRYNKHIWYESRNVRAEGRTRIKGRFAKAN 417
                    7889**************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.4E-94188IPR000315B-box-type zinc finger
CDDcd000214.73E-64576No hitNo description
PfamPF006431.2E-54586IPR000315B-box-type zinc finger
PROSITE profilePS501199.9974588IPR000315B-box-type zinc finger
PROSITE profilePS5011910.22484134IPR000315B-box-type zinc finger
PfamPF006435.0E-686118IPR000315B-box-type zinc finger
CDDcd000211.41E-688134No hitNo description
SMARTSM003360.9989134IPR000315B-box-type zinc finger
PROSITE profilePS5101713.056374416IPR010402CCT domain
PfamPF062035.0E-13374416IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MVNFRGDPGR REQQQPRYVV EEAAEQDEQL QQQQHLAAKV TLHGLCDFCG ESRAPLYCRA  60
DTAKLCFSCD REVHSGNPLF GKHSRSQLCD ACASKPASIF CSTDNLVLCQ NCDWDAHGGC  120
SSSSSSSLHD RRPLEGFSGC PSAVDLSSIL GFEDVGNKSL LLMGDAMDDC LVVSGPYGSM  180
GMADSFTDEL VRDTPVVSFD DLIVSSDSTH NFLPMVVPPL PKNRKSACGK HKEEILRQLC  240
KLAKLERSLS SENGVVESFL GLQPSVQERS FQTGYVDTGI EHGTGPTLAP GFDVNAFQWH  300
GDYSEAADQV PILITFPDNR SEENFLVLGE PGEDGSSGSH TNVGCKEQSQ HLIIRESLQG  360
LQKVGQHEPT RIDRDLAISR YKEKKKARRY NKHIWYESRN VRAEGRTRIK GRFAKAND
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245382.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 13-like isoform X1
TrEMBLF6HQ131e-116F6HQ13_VITVI; Putative uncharacterized protein
STRINGVIT_07s0104g01360.t011e-116(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47890.11e-74B-box type zinc finger protein with CCT domain